Package: iTALK 0.1.1
iTALK: Characterize and Illustrate Intercellular Communication
iTALK, a computational approach to characterize, compare, and illustrate intercellular communication signals in the multicellular ecosystem using either bulk RNA sequencing data or single cell RNAseq data. iTALK can in principle be used to dissect the complexity, diversity, and dynamics of cell-cell communication from a wide range of cellular processes.
Authors:
iTALK_0.1.1.tar.gz
iTALK_0.1.1.zip(r-4.7)iTALK_0.1.1.zip(r-4.6)iTALK_0.1.1.zip(r-4.5)
iTALK_0.1.1.tgz(r-4.6-any)iTALK_0.1.1.tgz(r-4.5-any)
iTALK_0.1.1.tar.gz(r-4.7-any)iTALK_0.1.1.tar.gz(r-4.6-any)
iTALK_0.1.1.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
DESCRIPTION |NEWS
card.svg |card.png
iTALK/json (API)
| # Install 'iTALK' in R: |
| install.packages('iTALK', repos = c('https://zaoqu-liu.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/zaoqu-liu/italk/issues
- database - Ligand-Receptor Interaction Database
rnasequencingsinglecellgeneexpressioncellbiology
Last updated from:b561893fcf (on main). Checks:7 NOTE, 2 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-x86_64 | NOTE | 222 | ||
| source / vignettes | OK | 338 | ||
| linux-release-x86_64 | NOTE | 214 | ||
| macos-release-arm64 | NOTE | 161 | ||
| macos-oldrel-arm64 | NOTE | 122 | ||
| windows-devel | NOTE | 150 | ||
| windows-release | NOTE | 153 | ||
| windows-oldrel | NOTE | 159 | ||
| wasm-release | OK | 174 |
Exports:convert_expression_matrixconvert_species_biomartDEGDESeq2TestDESingleTestdetect_speciesedgeRTestFindLRLRPlotMASTTestMonocleTestNetViewrawParseSCDETestTimePlotWilcoxTest
Dependencies:AnnotationDbiaskpassBiobaseBiocFileCacheBiocGenericsbiomaRtBiostringsbitbit64blobcachemcirclizecliclustercolorspacecpp11crayoncurlDBIdbplyrdigestdplyrfarverfastmapfilelockgenericsggplot2GlobalOptionsgluegtablehmshttrhttr2igraphIRangesisobandjsonliteKEGGRESTlabelinglatticelifecyclemagrittrMatrixmemoisemimeopensslpbapplypillarpkgconfigpngprettyunitsprogresspurrrR.cacheR.methodsS3R.ooR.utilsR6randomcoloRrappdirsRColorBrewerRcpprlangRSQLiteRtsneS4VectorsS7scalesSeqinfoshapestringistringrsystibbletidyrtidyselectutf8V8vctrsviridisLitewithrxml2XVector
Last update: 2026-01-23
Started: 2026-01-23
Last update: 2026-01-23
Started: 2026-01-23
Last update: 2026-01-23
Started: 2026-01-23
Last update: 2026-01-23
Started: 2026-01-23
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Convert Expression Matrix Between Species | convert_expression_matrix |
| Convert Genes Between Species Using BioMart | convert_species_biomart |
| Ligand-Receptor Interaction Database | database |
| Call DEGenes | DEG |
| Differential expression using DESeq2 | DESeq2Test |
| Differential expression using DEsingle | DESingleTest |
| Detect Species from Gene Names | detect_species |
| Differential expression using edgeR | edgeRTest |
| Finding ligand-receptor pairs | FindLR |
| Plotting ligand-receptor pairs | LRPlot |
| Differential expression using MAST | MASTTest |
| Differential expression using monocle | MonocleTest |
| Network Viewing of cell-cell communication | NetView |
| Parsing the data to get top expressed genes | rawParse |
| Differential expression using scde | SCDETest |
| Species Conversion System for iTALK | species_conversion |
| Plotting ligand-receptor pairs | TimePlot |
| Differential expression using wilcox | WilcoxTest |
